PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2039960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 681aa    MW: 76785.1 Da    PI: 6.7219
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2039960.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.7e-094474841954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Lj2g3v2039960.1 447 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 484
                      554459******************************88 PP

2BELL101.27.6e-33308379172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+ elqk+k+kLl +lee d+rY++y++++++v+ sFeav+g g+a++Y +lAlka+SrhFrcLkd i +q+
  Lj2g3v2039960.1 308 EFSELQKRKTKLLAMLEEGDRRYRHYRNKMKAVVYSFEAVVGNGAATVYSALALKAMSRHFRCLKDGILSQL 379
                      5689*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-50247377IPR006563POX domain
PfamPF075263.8E-43253375IPR006563POX domain
PROSITE profilePS5007112.082425488IPR001356Homeobox domain
SMARTSM003895.8E-9428492IPR001356Homeobox domain
CDDcd000863.17E-11428489No hitNo description
SuperFamilySSF466895.99E-17429494IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27431494IPR009057Homeodomain-like
PfamPF059209.2E-18445484IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MARQLCEEKA RDMVSSTGFC YSDHVQPGNQ TMQNHLANQI HGFVSDPEMY NLTTGMEMIG  60
FHKNLLHQQQ QQQSDHQNNN SAVWKSFFAK PGTPPSSSKN MNESCSNFYE HHGYSTNNKA  120
PDFTSGVSET STTSENLIMG AHDSWQDENH RLMVDDSSLR SVFPYHEGNN NKRPSQGLSL  180
SLNSTNPSRI GLQSFELRQT SQSTAGFTSP SSDSSREGYF AKSTISQQQQ MLLQEDQYLS  240
SKAANIYHGH FLLKNSRYLE PAQEILNEFC SLDIKQNHVL NQKSQKNKEW EEDNGGGSSK  300
KPSLTSLEFS ELQKRKTKLL AMLEEGDRRY RHYRNKMKAV VYSFEAVVGN GAATVYSALA  360
LKAMSRHFRC LKDGILSQLL VTRKTLGEKD PVAPGTTRGE TPRLKVIDQA LRQQRAFQQM  420
NMMETHPWRP QRGLPERSVS VLRAWLFEHF LHPYPSDVDK HILARQTGLS RSQVSNWFIN  480
ARVRLWKPMV EEMYLEEVKE RENNMASSEG ANTDPEDVHH NPPHSSEDQK PTPEHLVGID  540
SECASSIINN NNQEHKNELP DKHMIHQQEQ CFGSAELDFS SYTPHHSSGM VSYNDENGSQ  600
QSNFNGGGRS GGVSLTLGLQ QHGGSGVSLA FPPPTHQSSL FYSRDQIEDC QPVQYSLLDG  660
EGQNLPYRNL MGAQLLHDLA G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15434492563Homeobox protein Meis2
3k2a_A2e-15434492563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.26990.0pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158519.10.0hypothetical protein PHAVU_002G159000g
SwissprotQ388971e-136BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLV7CMC50.0V7CMC5_PHAVU; Uncharacterized protein
STRINGGLYMA11G02450.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-134TALE family protein